PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun005388
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 188aa    MW: 20163.4 Da    PI: 6.9467
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-26918PU_refplantGDBView CDS
gnl|UG|Vun#S45934578PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.42.1e-5823118297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+++re+egek
  Vun005388  23 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREMEGEK 118
                89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-5518130IPR009072Histone-fold
SuperFamilySSF471134.89E-4125131IPR009072Histone-fold
PfamPF008085.1E-282892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.7E-215674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.7E-217593No hitNo description
PRINTSPR006159.7E-2194112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MADSDNDSGG THNAGKGSEM SPREQDRFLP IANVSRIMKK ALPANAKISK DAKETVQECV  60
SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFEDY VEPLKVYLQR FREMEGEKTV  120
AARDKDAPPA SNATNSAYES GSYGAGGIMM HQGHVYASGG FHQVASSGAA IKGGPAYPGP  180
GSNANRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B8e-4920113194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-4920113194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523242.11e-136PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233107e-75NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0L9VBC01e-133A0A0L9VBC0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S6N11e-133A0A0S3S6N1_PHAAN; Uncharacterized protein
STRINGGLYMA18G08620.11e-125(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-75nuclear factor Y, subunit B3